Structure of PDB 3hdy Chain J

Receptor sequence

>3hdyJ (length=359) Species: 1299 (Deinococcus radiodurans)

FDYLIVGAGFAGSVLAERLASSGQRVLIVDRRPHIGGNAYDCYDDAGVLI
HPYGPHIFHTNSKDVFEYLSRFTEWRPYQHRVLASVDGQLLPIPINLDTV
NRLYGLNLTSFQVEEFFASVAEKVEQVRTSEDVVVSKVGRDLYNKFFRGY
TRKQWGLDPSELDASVTARVPTRTNRDNRYFADTYQAMPLHGYTRMFQNM
LSSPNIKVMLNTDYREIADFIPFQHMIYTGPVDAFFDFCYGKLPYRSLEF
RHETHDTEQLLPTGTVNYPNDYAYTRVSEFKHITGQRHHQTSVVYEYPRA
EGDPYYPVPRPENAELYKKYEALADAAQDVTFVGRLATYRYYNMDQVVAQ
ALATFRRLQ

3D structure

• PDB: 3hdy Structural basis of substrate binding to UDP-galactopyranose mutase: crystal structures in the reduced and oxidized state complexed with UDP-galactopyranose and UDP.
• Chain: J
• Resolution: 2.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R198 R202 R275 R305 E325 Y370 N372
• Catalytic site (residue number reindexed from 1): R169 R173 R246 R276 E296 Y341 N343
• Enzyme Commision number: 5.4.99.9: UDP-galactopyranose mutase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	J	V35 G38 A40 D59 R60 R61 G66 N67 P84 H85 I86 Y243 G259 P260 R364 Y371 N372 M373 V376	V6 G9 A11 D30 R31 R32 G37 N38 P55 H56 I57 Y214 G230 P231 R335 Y342 N343 M344 V347
BS02	GDU	J	F175 F176 Y179 T180 W184 R198 Y209 F210 N296 R305 Y335 Y370	F146 F147 Y150 T151 W155 R169 Y180 F181 N267 R276 Y306 Y341	MOAD: Kd=66uM

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0008767 UDP-galactopyranose mutase activity
• GO:0016853 isomerase activity
• GO:0050660 flavin adenine dinucleotide binding

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:3hdy, PDBe:3hdy, PDBj:3hdy
• PDBsum: 3hdy
• PubMed: 19836401
• UniProt: Q9RYF1