Structure of PDB 2zjr Chain J

Receptor sequence

>2zjrJ (length=136) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]

KRTKFRKQFRGRMTGDAKGGDYVAFGDYGLIAMEPAWIKSNQIEACRIVM
SRHFRRGGKIYIRIFPDKPVTKKPAETRMGKGKGAVEYWVSVVKPGRVMF
EVAGVTEEQAKEAFRLAGHKLPIQTKMVKREVYDEA

3D structure

PDB

2zjr Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.

Chain

Resolution

2.91 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	T8 K9 F10 K12 F14 R15 G16 R17 M18 K23 G24 D26 F30 N46 Q47 A50 Y66 R68 F70 K77 K78 E81 T82 R83 M84 G85 K86 G87 K88 R120 H124 K125 P127 A141	T3 K4 F5 K7 F9 R10 G11 R12 M13 K18 G19 D21 F25 N41 Q42 A45 Y61 R63 F65 K72 K73 E76 T77 R78 M79 G80 K81 G82 K83 R115 H119 K120 P122 A136
BS02	rna	J	T19 D21 E39 P40 K99	T14 D16 E34 P35 K94

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:2zjr, PDBe:2zjr, PDBj:2zjr
PDBsum	2zjr
PubMed	18406324
UniProt	Q9RXJ5\|RL16_DEIRA Large ribosomal subunit protein uL16 (Gene Name=rplP)