Structure of PDB 2zjp Chain J

Receptor sequence

>2zjpJ (length=136) Species: 1299 (Deinococcus radiodurans)

KRTKFRKQFRGRMTGDAKGGDYVAFGDYGLIAMEPAWIKSNQIEACRIVM
SRHFRRGGKIYIRIFPDKPVTKKPAETRMGKGKGAVEYWVSVVKPGRVMF
EVAGVTEEQAKEAFRLAGHKLPIQTKMVKREVYDEA

3D structure

• PDB: 2zjp Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
• Chain: J
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	T8 K9 F10 R11 K12 Q13 F14 R15 G16 R17 M18 K23 G24 D26 F30 Q47 Y66 R68 F70 K77 K78 T82 R83 M84 G85 K86 G87 K88 R120 H124 K125 Q129	T3 K4 F5 R6 K7 Q8 F9 R10 G11 R12 M13 K18 G19 D21 F25 Q42 Y61 R63 F65 K72 K73 T77 R78 M79 G80 K81 G82 K83 R115 H119 K120 Q124
BS02	rna	J	M18 T19 D21 E39 P40 K99	M13 T14 D16 E34 P35 K94

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:2zjp, PDBe:2zjp, PDBj:2zjp
• PDBsum: 2zjp
• PubMed: 18406324
• UniProt: Q9RXJ5|RL16_DEIRA Large ribosomal subunit protein uL16 (Gene Name=rplP)