Structure of PDB 2ri4 Chain J

Receptor sequence
>2ri4J (length=144) Species: 9925 (Capra hircus) [Search protein sequence]
LTAEEKAAVTGFWGKVKVDEVGAEALGRLLVVYPWTQRFFEHFGDLSSAD
AVMNNAKVKAHGKKVLDSFSNGMKHLDDLKGTFAQLSELHCDKLHVDPEN
FKLLGNVLVVVLARHHGSEFTPLLQAEFQKVVAGVANALAHRYH
3D structure
PDB2ri4 Crystallization of sheep (Ovis aries) and goat (Capra hircus) haemoglobins under unbuffered low-salt conditions
ChainJ
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM J F41 F42 H63 K66 S70 L88 L91 H92 L96 V98 N102 L106 F39 F40 H61 K64 S68 L86 L89 H90 L94 V96 N100 L104
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005344 oxygen carrier activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0031720 haptoglobin binding
GO:0031721 hemoglobin alpha binding
GO:0043177 organic acid binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport
GO:0042744 hydrogen peroxide catabolic process
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005833 hemoglobin complex
GO:0031838 haptoglobin-hemoglobin complex
GO:0072562 blood microparticle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ri4, PDBe:2ri4, PDBj:2ri4
PDBsum2ri4
PubMed
UniProtP02077|HBBA_CAPHI Hemoglobin subunit beta-A

[Back to BioLiP]