Structure of PDB 2irf Chain J

Receptor sequence
>2irfJ (length=109) Species: 10090 (Mus musculus) [Search protein sequence]
RMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPL
FRNWAIHTGKHQPGIDKPDPKTWKANFRCAMNSLPDIEEVKDRSIKKGNN
AFRVYRMLP
3D structure
PDB2irf Crystal structure of an IRF-DNA complex reveals novel DNA recognition and cooperative binding to a tandem repeat of core sequences.
ChainJ
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna J W638 H640 A641 K675 K678 R682 K700 R707 W34 H36 A37 K71 K74 R78 K96 R103 PDBbind-CN: Kd=0.17uM
BS02 dna J R607 M608 W658 T662 K664 N680 C683 L688 R3 M4 W54 T58 K60 N76 C79 L84 PDBbind-CN: Kd=0.17uM
BS03 dna J R643 K701 R39 K97 PDBbind-CN: Kd=0.17uM
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2irf, PDBe:2irf, PDBj:2irf
PDBsum2irf
PubMed10487755
UniProtP23906|IRF2_MOUSE Interferon regulatory factor 2 (Gene Name=Irf2)

[Back to BioLiP]