Structure of PDB 2a07 Chain J

Receptor sequence
>2a07J (length=83) Species: 9606 (Homo sapiens) [Search protein sequence]
IVRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAYFRRNAATWKNA
VRHNLSLHKCFVRVENVKGAVWTVDEVEYQKRR
3D structure
PDB2a07 Structure of the Forkhead Domain of FOXP2 Bound to DNA.
ChainJ
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna J R504 T508 Y509 T547 N550 H554 R583 R3 T7 Y8 T46 N49 H53 R82
BS02 dna J L527 R553 H554 S557 R564 W573 L26 R52 H53 S56 R63 W72
BS03 dna J I502 R543 I1 R42
BS04 dna J I502 V503 A539 I1 V2 A38
BS05 MG J L556 S557 H559 F562 L55 S56 H58 F61
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2a07, PDBe:2a07, PDBj:2a07
PDBsum2a07
PubMed16407075
UniProtO15409|FOXP2_HUMAN Forkhead box protein P2 (Gene Name=FOXP2)

[Back to BioLiP]