Structure of PDB 1znj Chain J

Receptor sequence
>1znjJ (length=30) Species: 9606 (Homo sapiens) [Search protein sequence]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
3D structure
PDB1znj Molecular Replacement: The Method and its Problems (in: Molecular Replacement. Proceedings of the Daresbury Study Weekend, 15-16 February, 1985. Compiled by P.A.Machin)
ChainJ
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide J F1 V2 H5 F1 V2 H5
BS02 peptide J F1 S9 H10 F1 S9 H10
BS03 peptide J C7 L11 L15 V18 C19 R22 G23 F24 F25 Y26 K29 C7 L11 L15 V18 C19 R22 G23 F24 F25 Y26 K29
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1znj, PDBe:1znj, PDBj:1znj
PDBsum1znj
PubMed
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]