Structure of PDB 1yhu Chain J

Receptor sequence
>1yhuJ (length=144) Species: 6426 (Riftia pachyptila) [Search protein sequence]
DYVCGPLQRLKVKRQWAEAYGSGNSREEFGHFIWSHVFQHSPAARDMFKR
VRGDNIHTPAFRAHATRVLGGLDMCIALLDDEPVLNTQLAHLAKQHETRG
VEAAHYDTVNHAVMMGVENVIGSEVFDQDAWKPCLNVITNGIQG
3D structure
PDB1yhu Sulfide binding is mediated by zinc ions discovered in the crystal structure of a hydrothermal vent tubeworm hemoglobin.
ChainJ
Resolution3.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN J H31 H57 H31 H57
BS02 ZN J H36 H40 H111 H36 H40 H111
BS03 HEM J F48 R50 H64 L92 Q95 H96 R99 V101 H105 Y106 I142 F48 R50 H64 L92 Q95 H96 R99 V101 H105 Y106 I142
BS04 OXY J W34 H64 V68 W34 H64 V68
Gene Ontology
Molecular Function
GO:0005344 oxygen carrier activity
GO:0005506 iron ion binding
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0001666 response to hypoxia
GO:0015671 oxygen transport
Cellular Component
GO:0005576 extracellular region
GO:0005833 hemoglobin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1yhu, PDBe:1yhu, PDBj:1yhu
PDBsum1yhu
PubMed15710902
UniProtP80592|GLBB_RIFPA Giant hemoglobins B chain

[Back to BioLiP]