Structure of PDB 1vqk Chain J

Receptor sequence

>1vqkJ (length=142) Species: 2238 (Haloarcula marismortui) [Search protein sequence]

AEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQI
VEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRV
YLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW

3D structure

PDB

1vqk Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.

Chain

Resolution

2.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	I18 G20 R21 S24 L31 T47 G48 R49 Q52 K59 R60 I63 N65 N67 G68 Y69 F70 P72 K73 K80 T82 R84 G85 M86 P88 H89 K90 R95 E99 R102 V103 K128	I15 G17 R18 S21 L28 T44 G45 R46 Q49 K56 R57 I60 N62 N64 G65 Y66 F67 P69 K70 K77 T79 R81 G82 M83 P85 H86 K87 R92 E96 R99 V100 K125

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:1vqk, PDBe:1vqk, PDBj:1vqk
PDBsum	1vqk
PubMed	16285925
UniProt	P29198\|RL13_HALMA Large ribosomal subunit protein uL13 (Gene Name=rpl13)