Structure of PDB 1tjl Chain J |
>1tjlJ (length=145) Species: 562 (Escherichia coli) [Search protein sequence] |
RKTSSLSILAIAGVEPYQEKPGEEYMNEAQLAHFRRILEAWRNQLRDEVD RTVTHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLKKV EDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG |
|
PDB | 1tjl Regulation through the secondary channel--structural framework for ppGpp-DksA synergism during transcription |
Chain | J |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
J |
C114 C135 C138 |
C108 C129 C132 |
|
|
|
|