Structure of PDB 1s7x Chain J

Receptor sequence
>1s7xJ (length=276) Species: 10090 (Mus musculus) [Search protein sequence]
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAP
WMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSG
CDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQS
GAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVT
LRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVP
LGKEQNYTCRVYHEGLPEPLTLRWEP
3D structure
PDB1s7x Determination of structural principles underlying three different modes of lymphocytic choriomeningitis virus escape from CTL recognition.
ChainJ
Resolution2.41 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 peptide J Y7 R62 E63 K66 Q70 W73 S77 N80 Y84 Q97 F116 Y123 T143 K146 W147 A152 H155 Y156 Y159 E163 W167 Y171 Y7 R62 E63 K66 Q70 W73 S77 N80 Y84 Q97 F116 Y123 T143 K146 W147 A152 H155 Y156 Y159 E163 W167 Y171
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0001913 T cell mediated cytotoxicity
GO:0001916 positive regulation of T cell mediated cytotoxicity
GO:0002474 antigen processing and presentation of peptide antigen via MHC class I
GO:0002485 antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent
GO:0006955 immune response
GO:0010977 negative regulation of neuron projection development
GO:0019882 antigen processing and presentation
Cellular Component
GO:0005886 plasma membrane
GO:0009897 external side of plasma membrane
GO:0016020 membrane
GO:0030670 phagocytic vesicle membrane
GO:0042612 MHC class I protein complex
GO:0098553 lumenal side of endoplasmic reticulum membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1s7x, PDBe:1s7x, PDBj:1s7x
PDBsum1s7x
PubMed15100292
UniProtP01899|HA11_MOUSE H-2 class I histocompatibility antigen, D-B alpha chain (Gene Name=H2-D1)

[Back to BioLiP]