Structure of PDB 1q86 Chain J

Receptor sequence

>1q86J (length=156) Species: 2238 (Haloarcula marismortui) [Search protein sequence]

KPGAMYRNSSKPAYTRREYISGIPGKKIAQFDMGNNGAGPTYPAQVELVV
EKPVQIRHNALEAARVAANRYVQNSGAAANYKFRIRKFPFHVIRENKDGM
RAPFGKPVGTAARVHGANHIFIAWVNPDPNVEEAWRRAKMKVTPTINIDS
SPAGNA

3D structure

PDB

1q86 Structural insights into peptide bond formation.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	K1 G3 M5 R7 K11 P12 A13 Y14 T15 R16 R17 E18 Y19 D32 R57 A60 A63 R70 R84 R86 K87 F88 F90 R94 E95 N96 M111 R112 A113 P114 F115 R147 M151 K152 T154 T156	K1 G3 M5 R7 K11 P12 A13 Y14 T15 R16 R17 E18 Y19 D32 R57 A60 A63 R70 R84 R86 K87 F88 F90 R94 E95 N96 M100 R101 A102 P103 F104 R136 M140 K141 T143 T145

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1q86, PDBe:1q86, PDBj:1q86
PDBsum	1q86
PubMed	12185246
UniProt	P60617\|RL10E_HALMA Large ribosomal subunit protein uL16 (Gene Name=rpl10e)

[Back to BioLiP]