Structure of PDB 1n36 Chain J

Receptor sequence
>1n36J (length=98) Species: 274 (Thermus thermophilus) [Search protein sequence]
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRG
PFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
3D structure
PDB1n36 Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
ChainJ
Resolution3.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna J R5 K7 H13 S35 G36 P37 P39 L40 P41 T42 R43 V44 I50 R51 F54 K55 H56 K57 S59 R60 H62 H68 R3 K5 H11 S33 G34 P35 P37 L38 P39 T40 R41 V42 I48 R49 F52 K53 H54 K55 S57 R58 H60 H66 PDBbind-CN: Kd=150uM
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1n36, PDBe:1n36, PDBj:1n36
PDBsum1n36
PubMed12464183
UniProtQ5SHN7|RS10_THET8 Small ribosomal subunit protein uS10 (Gene Name=rpsJ)

[Back to BioLiP]