Structure of PDB 1mow Chain J

Receptor sequence

>1mowJ (length=234) Species: 2275,3055

NVSGISAYLLGLIWGDGGLYKLKYNRSEYRVVTQKSENLIKQFIAPRMQF
LIDELNVSKIQIVKDTRYELRVSSKKLYYYFANMLERIRLFNGNRFLAYL
AGIVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTQKRRWFVDEIGVGYVRD
RGSVSDYILSEIKPLHNFLTQLQPFLNFKQKQANLVLKIIEQLPAKESPD
KFLEVCTWVDQIAALNDSKTRTTSETVRAVLDSL

3D structure

• PDB: 1mow Design, Activity and Structure of a Highly Specific Artificial Endonuclease
• Chain: J
• Resolution: 2.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): G1616 D1617
• Catalytic site (residue number reindexed from 1): G106 D107
• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	J	G1520 D1521 G1522 Q1542 K1543 T1576 R1577 S1629 K1631 E1677 I1678	G15 D16 G17 Q34 K35 T66 R67 S119 K121 E161 I162
BS02	dna	J	N1532 S1534 S1567 K1568 S1583 S1584 K1585 G1616 D1617 G1618 S1619 T1643 Q1644 K1645 A1730 N1733 D1734 S1735 R1738	N25 S27 S58 K59 S73 S74 K75 G106 D107 G108 S109 T133 Q134 K135 A213 N216 D217 S218 R221

Gene Ontology

Molecular Function

• GO:0004519 endonuclease activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006314 intron homing

Cellular Component

• GO:0009507 chloroplast

External links

• PDB: RCSB:1mow, PDBe:1mow, PDBj:1mow
• PDBsum: 1mow
• PubMed: 12419232
• UniProt: P05725|DNE1_CHLRE DNA endonuclease I-CreI;
  P21505|DMO1_DESMO Homing endonuclease I-DmoI