Structure of PDB 1k73 Chain J

Receptor sequence

>1k73J (length=156) Species: 2238 (Haloarcula marismortui)

KPGAMYRNSSKPAYTRREYISGIPGKKIAQFDMGNNGAGPTYPAQVELVV
EKPVQIRHNALEAARVAANRYVQNSGAAANYKFRIRKFPFHVIRENKDGM
RAPFGKPVGTAARVHGANHIFIAWVNPDPNVEEAWRRAKMKVTPTINIDS
SPAGNA

3D structure

• PDB: 1k73 Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
• Chain: J
• Resolution: 3.01 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	K1 G3 M5 R7 K11 P12 A13 Y14 T15 R16 E18 Y19 D32 R57 A63 R70 R84 R86 K87 F88 F90 R94 E95 N96 M111 R112 A113 P114 F115 R147 R148 M151 K152 T154 T156	K1 G3 M5 R7 K11 P12 A13 Y14 T15 R16 E18 Y19 D32 R57 A63 R70 R84 R86 K87 F88 F90 R94 E95 N96 M100 R101 A102 P103 F104 R136 R137 M140 K141 T143 T145

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1k73, PDBe:1k73, PDBj:1k73
• PDBsum: 1k73
• PubMed: 12860128
• UniProt: P60617|RL10E_HALMA Large ribosomal subunit protein uL16 (Gene Name=rpl10e)