Structure of PDB 1i94 Chain J

Receptor sequence
>1i94J (length=98) Species: 274 (Thermus thermophilus) [Search protein sequence]
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRG
PFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
3D structure
PDB1i94 Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
ChainJ
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna J S35 G36 P37 I38 P39 L40 P41 T42 V44 R51 G52 P53 K55 K57 S33 G34 P35 I36 P37 L38 P39 T40 V42 R49 G50 P51 K53 K55
BS02 WO2 J K14 A18 L90 P91 K12 A16 L88 P89
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1i94, PDBe:1i94, PDBj:1i94
PDBsum1i94
PubMed11296217
UniProtQ5SHN7|RS10_THET8 Small ribosomal subunit protein uS10 (Gene Name=rpsJ)

[Back to BioLiP]