Structure of PDB 1eq2 Chain J

Receptor sequence

>1eq2J (length=300) Species: 562 (Escherichia coli)

MIIVTGGAGFIGSNIVKALNDKGITDILVVDNLKDGTKFVNLVDLNIADY
MDKEDFLIQIMAGEEFGDVEAIFHEGACSSTTEWDGKYMMDNNYQYSKEL
LHYCLEREIPFLYASSAATYGGRTSDFIESREYEKPLNVYGYSKFLFDEY
VRQILPEANSQIVGFRYFNVYGPREGHKGSMASVAFHLNTQLNNGESPKL
FEGSENFKRDFVYVGDVADVNLWFLENGVSGIFNLGTGRAESFQAVADAT
LAYHKKGQIEYIPFYQAFTQADLTNLRAAGYDKPFKTVAEGVTEYMAWLN

3D structure

• PDB: 1eq2 The crystal structure of ADP-L-glycero-D-mannoheptose 6-epimerase: catalysis with a twist.
• Chain: J
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S116 Y140 K144 K178
• Catalytic site (residue number reindexed from 1): S116 Y140 K144 K178
• Enzyme Commision number: 5.1.3.20: ADP-glyceromanno-heptose 6-epimerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	J	G6 G9 F10 I11 D31 N32 K38 K53 E75 G76 A77 N92 Y96 A114 S116 Y140 K144 Y167 F168 V170 K178	G6 G9 F10 I11 D31 N32 K38 K53 E75 G76 A77 N92 Y96 A114 S116 Y140 K144 Y167 F168 V170 K178
BS02	ADQ	J	S180 V184 H187 L200 F201 R209 F243 Y272	S180 V184 H187 L200 F201 R209 F243 Y265

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008712 ADP-glyceromanno-heptose 6-epimerase activity
• GO:0016853 isomerase activity
• GO:0050661 NADP binding
• GO:0070401 NADP+ binding

Biological Process

• GO:0005975 carbohydrate metabolic process
• GO:0009103 lipopolysaccharide biosynthetic process
• GO:0009244 lipopolysaccharide core region biosynthetic process
• GO:0097171 ADP-L-glycero-beta-D-manno-heptose biosynthetic process

Cellular Component

• GO:0005829 cytosol
• GO:0016020 membrane

External links

• PDB: RCSB:1eq2, PDBe:1eq2, PDBj:1eq2
• PDBsum: 1eq2
• PubMed: 10896473
• UniProt: P67910|HLDD_ECOLI ADP-L-glycero-D-manno-heptose-6-epimerase (Gene Name=hldD)