Structure of PDB 1ea4 Chain J

Receptor sequence
>1ea4J (length=44) Species: 1311 (Streptococcus agalactiae) [Search protein sequence]
MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQE
3D structure
PDB1ea4 Plasmid Transcriptional Repressor Copg Oligomerises to Render Helical Superstructures Unbound and in Complexes with Oligonucleotides
ChainJ
Resolution2.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna J R4 S29 R4 S29
BS02 dna J L5 T6 T8 L5 T6 T8
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006276 plasmid maintenance
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ea4, PDBe:1ea4, PDBj:1ea4
PDBsum1ea4
PubMed11428897
UniProtP13920|COPG_STRAG Protein CopG (Gene Name=copG)

[Back to BioLiP]