Structure of PDB 6t83 Chain Iy

Receptor sequence

>6t83Iy (length=218) Species: 4932 (Saccharomyces cerevisiae)

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MLSCAGADRLQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEG
LRRARYKFPGQQKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLS
KKGSLENNIREFPEYFAA

3D structure

• PDB: 6t83 Molecular mechanism of translational stalling by inhibitory codon combinations and poly(A) tracts.
• Chain: Iy
• Resolution: 4.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Iy	E56 K202 G204 L206	E55 K201 G203 L205
BS02	rna	Iy	R3 R4 A6 R7 Y9 N14 K15 P16 Y22 D35 K39 K40 S61 E63 A64 K74 R90 H92 F94 R98 M102 S104 R110 Q112 G114 M115 R116 G117 A118 R154 Y157 K158 P160 D193 G194 A195 K198	R2 R3 A5 R6 Y8 N13 K14 P15 Y21 D34 K38 K39 S60 E62 A63 K73 R89 H91 F93 R97 M101 S103 R109 Q111 G113 M114 R115 G116 A117 R153 Y156 K157 P159 D192 G193 A194 K197

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006415 translational termination

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6t83, PDBe:6t83, PDBj:6t83
• PDBsum: 6t83
• PubMed: 31858614
• UniProt: P41805|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)