Structure of PDB 8ppl Chain Is

Receptor sequence

>8pplIs (length=159) Species: 9606 (Homo sapiens)

DYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNF
TDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLR
RYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVT
GKRAQLRAK

3D structure

• PDB: 8ppl Universal features of Nsp1-mediated translational shutdown by coronaviruses.
• Chain: Is
• Resolution: 2.65 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Is	T214 S249 D251 K293 R296 Q327 K331	T42 S77 D79 K121 R124 Q155 K159
BS02	rna	Is	K324 R325 R329	K152 R153 R157
BS03	ZN	Is	C281 C302	C109 C130
BS04	GTP	Is	T283 S307	T111 S135

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003743 translation initiation factor activity
• GO:0005515 protein binding
• GO:0008135 translation factor activity, RNA binding
• GO:0031369 translation initiation factor binding
• GO:0046872 metal ion binding

Biological Process

• GO:0001701 in utero embryonic development
• GO:0001731 formation of translation preinitiation complex
• GO:0002176 male germ cell proliferation
• GO:0002183 cytoplasmic translational initiation
• GO:0006412 translation
• GO:0006413 translational initiation
• GO:0008584 male gonad development

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005850 eukaryotic translation initiation factor 2 complex
• GO:0045202 synapse

External links

• PDB: RCSB:8ppl, PDBe:8ppl, PDBj:8ppl
• PDBsum: 8ppl
• PubMed: 37802027
• UniProt: P20042|IF2B_HUMAN Eukaryotic translation initiation factor 2 subunit 2 (Gene Name=EIF2S2)