Structure of PDB 8ppl Chain Iq

Receptor sequence
>8pplIq (length=103) Species: 9606 (Homo sapiens) [Search protein sequence]
EKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWI
NTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKDDEIQFD
DIG
3D structure
PDB8ppl Universal features of Nsp1-mediated translational shutdown by coronaviruses.
ChainIq
Resolution2.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Iq L42 G43 N44 G45 R62 G63 K64 L65 R66 K67 W70 L21 G22 N23 G24 R41 G42 K43 L44 R45 K46 W49
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003743 translation initiation factor activity
GO:0005515 protein binding
GO:0008135 translation factor activity, RNA binding
Biological Process
GO:0006412 translation
GO:0006413 translational initiation
GO:0042255 ribosome assembly
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016282 eukaryotic 43S preinitiation complex
GO:0033290 eukaryotic 48S preinitiation complex
GO:0043614 multi-eIF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ppl, PDBe:8ppl, PDBj:8ppl
PDBsum8ppl
PubMed37802027
UniProtP47813|IF1AX_HUMAN Eukaryotic translation initiation factor 1A, X-chromosomal (Gene Name=EIF1AX)

[Back to BioLiP]