Structure of PDB 8rdv Chain IX

Receptor sequence

>8rdvIX (length=142) Species: 45610 (Psychrobacter urativorans) [Search protein sequence]

MKTLSAKPAEVTHDWFVVDADGKTLGRLATQIASRLRGKHKTNYTPHVDT
GDFIVVINAEKIAVTGKKAQDKKYYRHSGYPGGIKETNFTKLIAHKPEDV
LHKAVKGMLPKGPLGYAMIKKLKLYAGTDHPHEAQQPKELDI

3D structure

PDB

8rdv A bacterial ribosome hibernation factor with evolutionary connections to eukaryotic protein synthesis

Chain

Resolution

2.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	IX	T3 S5 W15 T24 L25 G26 R27 T30 R37 K39 H47 F53 T65 K68 K72 Y75 R76 H77 S78 Y80 P81 G82 I84 H95 K96 A104 K106 G107 M108 P110 K111 P113 L114 Y116 K123 P131 H132 A134 Q135	T3 S5 W15 T24 L25 G26 R27 T30 R37 K39 H47 F53 T65 K68 K72 Y75 R76 H77 S78 Y80 P81 G82 I84 H95 K96 A104 K106 G107 M108 P110 K111 P113 L114 Y116 K123 P131 H132 A134 Q135

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links