Structure of PDB 8rd8 Chain IX

Receptor sequence

>8rd8IX (length=142) Species: 45610 (Psychrobacter urativorans) [Search protein sequence]

MKTLSAKPAEVTHDWFVVDADGKTLGRLATQIASRLRGKHKTNYTPHVDT
GDFIVVINAEKIAVTGKKAQDKKYYRHSGYPGGIKETNFTKLIAHKPEDV
LHKAVKGMLPKGPLGYAMIKKLKLYAGTDHPHEAQQPKELDI

3D structure

PDB

8rd8 A new family of bacterial ribosome hibernation factors

Chain

Resolution

2.62 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	IX	K2 T3 S5 K7 P8 W15 T24 G26 R27 T30 R37 K39 P46 H47 F53 T65 K67 K68 K72 Y75 R76 H77 S78 Y80 P81 G82 I84 H95 K96 A104 G107 M108 K111 P113 L114 Y116 H132 A134 Q135	K2 T3 S5 K7 P8 W15 T24 G26 R27 T30 R37 K39 P46 H47 F53 T65 K67 K68 K72 Y75 R76 H77 S78 Y80 P81 G82 I84 H95 K96 A104 G107 M108 K111 P113 L114 Y116 H132 A134 Q135

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links