Structure of PDB 7m50 Chain II |
>7m50II (length=143) Species: 12881 (Satellite tobacco mosaic virus) [Search protein sequence] |
SNVVTMIRAGSYPKVNPTPTWVRAIPFEVSVQSGIAFKVPVGSLFSANFR TDSFTSVTVMSVRAWTQLTPPVNEYSFVRLKPLFKTGDSTEEFEGRASNI NTRASVGYRIPTNLRQNTVAADNVCEVRSNCRQVALVISCCFN |
|
PDB | 7m50 Structures of additional crystal forms of Satellite tobacco mosaic virus grown from a variety of salts. |
Chain | II |
Resolution | 2.31 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
II |
V38 A40 |
V22 A24 |
|
|
|
|