Structure of PDB 5it7 Chain II

Receptor sequence

>5it7II (length=207) Species: 28985 (Kluyveromyces lactis) [Search protein sequence]

RRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVHL
VSNELEQLSSEALEAARITANKYITKMTGRDSFHLRVRVHPFHVLRINKM
QQGMRGAWGKPHGLAARVAIGQVIFSVRTKDNNKDTVIEGLRRARYKFPG
QQKIIISKKWGFTSLNREEYVKKRDAGEIKDDGAFVKFLSKKGSLEENIR
EFPEYFA

3D structure

PDB

5it7 Structural characterization of ribosome recruitment and translocation by type IV IRES.

Chain

Resolution

3.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	II	R3 R4 P5 A6 R7 C8 R10 K13 N14 K15 Y17 Y22 R32 D35 K39 K40 S61 E63 A64 A67 K74 K78 R88 R90 H92 F94 R98 N100 M115 R116 W119 Q133 Y157 K158 P160 D193 G194 A195 F196 K198	R1 R2 P3 A4 R5 C6 R8 K11 N12 K13 Y15 Y20 R30 D33 K37 K38 S59 E61 A62 A65 K72 K76 R86 R88 H90 F92 R96 N98 M104 R105 W108 Q122 Y146 K147 P149 D182 G183 A184 F185 K187
BS02	rna	II	Y11 E56 I131 K202 K203 G204 S205 L206	Y9 E54 I120 K191 K192 G193 S194 L195

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5it7, PDBe:5it7, PDBj:5it7
PDBsum	5it7
PubMed	27159451
UniProt	Q6CRX7

[Back to BioLiP]