Structure of PDB 6boh Chain IC

Receptor sequence

>6bohIC (length=53) Species: 262724 (Thermus thermophilus HB27)

ASEVRIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHRE
VKI

3D structure

• PDB: 6boh Conformational Control of Translation Termination on the 70S Ribosome.
• Chain: IC
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	IC	A2 S3 R6 K8 R19 Y21 T23 E24 N29 L34 L36 R37 K38 Y39 W42 R44 H46	A1 S2 R5 K7 R18 Y20 T22 E23 N28 L33 L35 R36 K37 Y38 W41 R43 H45
BS02	ZN	IC	C40 C43	C39 C42

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6boh, PDBe:6boh, PDBj:6boh
• PDBsum: 6boh
• PubMed: 29731232
• UniProt: Q72GW3|RL33_THET2 Large ribosomal subunit protein bL33 (Gene Name=rpmG)