Structure of PDB 8ipb Chain IA

Receptor sequence

>8ipbIA (length=144) Species: 4565 (Triticum aestivum) [Search protein sequence]

TTRFKKNRKKRGHVSAGHGRVGKHRKHPGGRGNAGGMHHHRILFDKYHPG
YFGKVGMRYFHKLSNRFYTPTVNVERLWSMVPSDKAAEAGGDKAPVVDVS
QFGYFKVLGKGMLPEKPIVVKAKLISKIAEKKIKAAGGAVVLVA

3D structure

PDB

8ipb Boric acid intercepts 80S ribosome migration from AUG-stop by stabilizing eRF1.

Chain

Resolution

3.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	IA	T2 T3 R4 K6 K7 N8 R9 K10 K11 R12 G13 V15 A17 G18 H19 G20 R21 V22 G23 H25 R26 K27 H28 P29 G31 R32 G33 N34 G36 M38 H39 H40 H41 R42 I43 L44 K47 Y52 F53 G54 K55 V56 G57 M58 R59 Y60 F61 H62 K63 N66 R67 T72 N74 R77 Q102 F103 G104 K107 L109 G110 K111 G112 M113 S127 K128 I129 K132 K133	T1 T2 R3 K5 K6 N7 R8 K9 K10 R11 G12 V14 A16 G17 H18 G19 R20 V21 G22 H24 R25 K26 H27 P28 G30 R31 G32 N33 G35 M37 H38 H39 H40 R41 I42 L43 K46 Y51 F52 G53 K54 V55 G56 M57 R58 Y59 F60 H61 K62 N65 R66 T71 N73 R76 Q101 F102 G103 K106 L108 G109 K110 G111 M112 S126 K127 I128 K131 K132

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links