Structure of PDB 4wro Chain I8

Receptor sequence

>4wroI8 (length=80) Species: 300852 (Thermus thermophilus HB8)

ALASTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGR
DFTLFALVDGVVEFQDRGRLGRYVHVRPLA

3D structure

• PDB: 4wro Structural insights into the translational infidelity mechanism.
• Chain: I8
• Resolution: 3.05 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I8	R11 N12 R14 D15 S16 Q17 A18 K19 R20 K24 R25 Y26 E27 Q29 R32 A33 G34 N35 I36 R39 R41 G42 T43 R44 F45 G54 R55 D56 F57 F60 F69 R74 R77	R6 N7 R9 D10 S11 Q12 A13 K14 R15 K19 R20 Y21 E22 Q24 R27 A28 G29 N30 I31 R34 R36 G37 T38 R39 F40 G49 R50 D51 F52 F55 F64 R69 R72
BS02	rna	I8	R72 R74	R67 R69

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4wro, PDBe:4wro, PDBj:4wro
• PDBsum: 4wro
• PubMed: 26037619
• UniProt: P60493|RL27_THET8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)