Structure of PDB 5m1j Chain I5

Receptor sequence

>5m1jI5 (length=211) Species: 4932 (Saccharomyces cerevisiae)

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEGLRRARYKFP
GQQKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLSKKGSLENNI
REFPEYFAAQA

3D structure

• PDB: 5m1j Structural insights into ribosomal rescue by Dom34 and Hbs1 at near-atomic resolution.
• Chain: I5
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I5	R3 R4 A6 R7 C8 R10 K13 N14 K15 P16 Y17 Y22 D35 K39 S61 E63 A64 A67 K74 R90 H92 F94 R98 N100 Q113 M115 R116 A118 W119 Q133 Y157 K158 P160 G194 F196 K198	R2 R3 A5 R6 C7 R9 K12 N13 K14 P15 Y16 Y21 D34 K38 S60 E62 A63 A66 K73 R89 H91 F93 R97 N99 Q103 M105 R106 A108 W109 Q123 Y147 K148 P150 G184 F186 K188
BS02	rna	I5	Y11 E56 L57 I131 G204 L206	Y10 E55 L56 I121 G194 L196
BS03	MG	I5	G194 A195 F196	G184 A185 F186
BS04	MG	I5	K101 M102	K100 M101
BS05	MG	I5	R10 Y11	R9 Y10

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006415 translational termination

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5m1j, PDBe:5m1j, PDBj:5m1j
• PDBsum: 5m1j
• PubMed: 27995908
• UniProt: P41805|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)