Structure of PDB 7fix Chain I3

Receptor sequence
>7fixI3 (length=38) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
MMGSYAASFLPWIFIPVVCWLMPTVVMGLLFLYIEGEA
3D structure
PDB7fix Structure of cyanobacterial photosystem I complexed with ferredoxin at 1.97 angstrom resolution.
ChainI3
Resolution1.97 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA I3 P11 F14 V18 P11 F14 V18
BS02 CLA I3 T24 F31 T24 F31
BS03 CLA I3 M27 G28 M27 G28
BS04 CLA I3 C19 W20 C19 W20
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7fix, PDBe:7fix, PDBj:7fix
PDBsum7fix
PubMed36097054
UniProtP0A427|PSAI_THEVB Photosystem I reaction center subunit VIII (Gene Name=psaI)

[Back to BioLiP]