Structure of PDB 6hcq Chain I3

Receptor sequence

>6hcqI3 (length=205) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

GRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGH
MVSDEYEQLSSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINK
MLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVVEALRRAKFKF
PGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYIPNRGPLDKW
RALHS

3D structure

PDB

6hcq ZNF598 Is a Quality Control Sensor of Collided Ribosomes.

Chain

Resolution

6.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	I3	R3 R4 A6 R7 C8 K15 Y17 F22 D35 K39 K40 E63 K74 R88 R90 H92 R98 N100 M115 R116 G117 A118 F119 G120 F157 K158 D193	R2 R3 A5 R6 C7 K14 Y16 F21 D34 K38 K39 E62 K73 R87 R89 H91 R97 N99 M106 R107 G108 A109 F110 G111 F148 K149 D184
BS02	rna	I3	Y11 E56 Y57 R203 G204 L206	Y10 E55 Y56 R194 G195 L197
BS03	rna	I3	G25 K101	G24 K100

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation
GO:0006417	regulation of translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6hcq, PDBe:6hcq, PDBj:6hcq
PDBsum	6hcq
PubMed	30293783
UniProt	B7NZQ2\|RL10_RABIT Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]