Structure of PDB 6gzx Chain I3

Receptor sequence

>6gzxI3 (length=127) Species: 300852 (Thermus thermophilus HB8)

EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLR
AVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGF
LTRDARVVERKKYGKHKARRAPQYSKR

3D structure

• PDB: 6gzx Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.
• Chain: I3
• Resolution: 4.57 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I3	Y5 T7 R9 K11 R16 F18 R20 Q38 G39 R42 Y62 R66 G67 G68 G69 K70 R83 K97 T103 R104 A106 R107 V108 V109 E110 R111 K112 Y114 K118 R120 R121 A122 P123 Q124 Y125 S126 K127 R128	Y4 T6 R8 K10 R15 F17 R19 Q37 G38 R41 Y61 R65 G66 G67 G68 K69 R82 K96 T102 R103 A105 R106 V107 V108 E109 R110 K111 Y113 K117 R119 R120 A121 P122 Q123 Y124 S125 K126 R127

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6gzx, PDBe:6gzx, PDBj:6gzx
• PDBsum: 6gzx
• PubMed: 30301898
• UniProt: P80374|RS9_THET8 Small ribosomal subunit protein uS9 (Gene Name=rpsI)