Structure of PDB 8rcl Chain I2

Receptor sequence

>8rclI2 (length=129) Species: 562 (Escherichia coli) [Search protein sequence]

AENQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQP
LELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKA
GFVTRDARQVERKKVGLRKARRRPQFSKR

3D structure

PDB

8rcl Transient disome complex formation in native polysomes during ongoing protein synthesis captured by cryo-EM.

Chain

Resolution

3.49 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I2	Q5 Y7 T9 R11 R12 K13 A16 R18 Y38 Y64 G69 G70 G71 I72 S73 G74 Q75 R85 R95 R99 T105 R106 R109 Q110 E112 R113 K114 K115 V116 G117 K120 A121 R122 R123 Q126 F127 K129 R130	Q4 Y6 T8 R10 R11 K12 A15 R17 Y37 Y63 G68 G69 G70 I71 S72 G73 Q74 R84 R94 R98 T104 R105 R108 Q109 E111 R112 K113 K114 V115 G116 K119 A120 R121 R122 Q125 F126 K128 R129
BS02	rna	I2	K129 R130	K128 R129

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8rcl, PDBe:8rcl, PDBj:8rcl
PDBsum	8rcl
PubMed	38409277
UniProt	P0A7X3\|RS9_ECOLI Small ribosomal subunit protein uS9 (Gene Name=rpsI)