Structure of PDB 7oyb Chain I2

Receptor sequence

>7oybI2 (length=206) Species: 7955 (Danio rerio)

GISRDNWHKRRRTGGKRKPVHKKRKYELGRPAANTKIGPRRIHTIRVRGG
NKKYRALRLDVGNFSWGSECCTRKTRIIDVVYNASNNELVRTKTLVKNCV
VLVDSTPYRQWYESHYALPLGRKKGAKLTPEEEEILNKKRSKKVQKKFTL
RRKTAKISPLLEEQFLQGKLLACISSRPGQCGRADGYVLEGKELEFYLRK
IKAKKG

3D structure

• PDB: 7oyb A molecular network of conserved factors keeps ribosomes dormant in the egg.
• Chain: I2
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I2	G2 I3 R5 D6 H9 K10 R11 R12 T14 G15 G16 K19 H22 K23 K24 R25 K26 Y27 L29 R31 A33 A34 R42 R47 V48 R49 G50 G51 N52 K54 Y55 L58 N64 C71 C72 T73 K75 S86 K98 N99 S176 S177 R178 Q181 R184 D186 G187	G1 I2 R4 D5 H8 K9 R10 R11 T13 G14 G15 K18 H21 K22 K23 R24 K25 Y26 L28 R30 A32 A33 R41 R46 V47 R48 G49 G50 N51 K53 Y54 L57 N63 C70 C71 T72 K74 S85 K97 N98 S175 S176 R177 Q180 R183 D185 G186
BS02	rna	I2	E89 R92 K206 G207	E88 R91 K205 G206

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation
• GO:0042274 ribosomal small subunit biogenesis
• GO:0043009 chordate embryonic development
• GO:0051726 regulation of cell cycle

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0016020 membrane
• GO:0022627 cytosolic small ribosomal subunit
• GO:0032040 small-subunit processome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7oyb, PDBe:7oyb, PDBj:7oyb
• PDBsum: 7oyb
• PubMed: 36653451
• UniProt: P62247|RS8_DANRE Small ribosomal subunit protein eS8 (Gene Name=rps8)