Structure of PDB 7oya Chain I2

Receptor sequence

>7oyaI2 (length=188) Species: 7955 (Danio rerio)

GISRDNWHKRRRTGGKRKPVHKKRKYELGRPAANTKIGPRRIHTIRVRGG
NKKYRALRLDVGNFSWGSECCTRKTRIIDVVYNASNNELVRTKTLVKNCV
VLVDSTPYRQWYESHYALPLGRSKKVQKKFTLRRKTAKISPLLEEQFLQG
KLLACISSRPGQCGRADGYVLEGKELEFYLRKIKAKKG

3D structure

• PDB: 7oya A molecular network of conserved factors keeps ribosomes dormant in the egg.
• Chain: I2
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I2	G2 I3 R5 D6 N7 H9 K10 R11 R12 T14 G16 K19 V21 H22 K23 K24 R25 K26 Y27 L29 R31 A34 R42 I43 H44 T45 R47 V48 R49 G50 K53 K54 Y55 R56 L58 R59 N64 S66 T73 R74 K75 S86 K98 N99 V145 K148 R152 S176 Q181 C182 R184 D186 G187	G1 I2 R4 D5 N6 H8 K9 R10 R11 T13 G15 K18 V20 H21 K22 K23 R24 K25 Y26 L28 R30 A33 R41 I42 H43 T44 R46 V47 R48 G49 K52 K53 Y54 R55 L57 R58 N63 S65 T72 R73 K74 S85 K97 N98 V126 K129 R133 S157 Q162 C163 R165 D167 G168
BS02	rna	I2	N88 R92 K205	N87 R91 K186

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation
• GO:0042274 ribosomal small subunit biogenesis
• GO:0043009 chordate embryonic development
• GO:0051726 regulation of cell cycle

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0016020 membrane
• GO:0022627 cytosolic small ribosomal subunit
• GO:0032040 small-subunit processome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7oya, PDBe:7oya, PDBj:7oya
• PDBsum: 7oya
• PubMed: 36653451
• UniProt: P62247|RS8_DANRE Small ribosomal subunit protein eS8 (Gene Name=rps8)