Structure of PDB 5zf0 Chain I2

Receptor sequence
>5zf0I2 (length=38) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
MMGSYAASFLPWIFIPVVCWLMPTVVMGLLFLYIEGEA
3D structure
PDB5zf0 X-ray structure of an asymmetrical trimeric ferredoxin-photosystem I complex
ChainI2
Resolution4.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA I2 L10 P11 F14 I15 V18 L10 P11 F14 I15 V18
BS02 CLA I2 C19 P23 V26 C19 P23 V26
BS03 CLA I2 C19 W20 C19 W20
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5zf0, PDBe:5zf0, PDBj:5zf0
PDBsum5zf0
PubMed29610537
UniProtP0A427|PSAI_THEVB Photosystem I reaction center subunit VIII (Gene Name=psaI)

[Back to BioLiP]