Structure of PDB 8rct Chain I1

Receptor sequence

>8rctI1 (length=127) Species: 562 (Escherichia coli) [Search protein sequence]

NQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLE
LVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGF
VTRDARQVERKKVGLRKARRRPQFSKR

3D structure

PDB

8rct Transient disome complex formation in native polysomes during ongoing protein synthesis captured by cryo-EM.

Chain

Resolution

5.32 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I1	Q5 Y7 R11 R12 K13 S14 A16 R18 F20 R33 Y64 G69 G70 G71 I72 S73 Q75 R85 R95 R99 T105 R106 R109 Q110 E112 R113 K114 K115 G117 R119 K120 R122 R123 Q126 F127 K129	Q2 Y4 R8 R9 K10 S11 A13 R15 F17 R30 Y61 G66 G67 G68 I69 S70 Q72 R82 R92 R96 T102 R103 R106 Q107 E109 R110 K111 K112 G114 R116 K117 R119 R120 Q123 F124 K126

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8rct, PDBe:8rct, PDBj:8rct
PDBsum	8rct
PubMed	38409277
UniProt	P0A7X3\|RS9_ECOLI Small ribosomal subunit protein uS9 (Gene Name=rpsI)