Structure of PDB 7oya Chain I1

Receptor sequence

>7oyaI1 (length=201) Species: 7955 (Danio rerio)

RRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKAKVDEFPLCAHM
VSDEYEQLSSEALEAARICANKYMVKTCGKDGFHIRVRLHPFHVIRINKM
LGMRGAFGKPQGTVARVHIGQVIMSVRTKAQNKEHVIEALRRAKFKFPGR
QKIHVSKKYGFTKFNTCDFDNMLAEKRLIPDGCGVKYIPSRGPLSRWKAL
H

3D structure

• PDB: 7oya A molecular network of conserved factors keeps ribosomes dormant in the egg.
• Chain: I1
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I1	R3 R4 A6 R7 C8 Y9 K13 N14 K15 P16 F22 D35 K39 E63 A64 A67 K74 R90 H92 F94 R98 N100 L103 G114 M115 R116 G117 A118 F119 Q133 R154 F157 K158 P160 R162 G194 K198	R1 R2 A4 R5 C6 Y7 K11 N12 K13 P14 F20 D33 K37 E61 A62 A65 K72 R88 H90 F92 R96 N98 L101 G102 M103 R104 G105 A106 F107 Q121 R142 F145 K146 P148 R150 G182 K186
BS02	rna	I1	Y11 E56 Y57 I131 Y199 S202 R203 G204 P205 L206	Y9 E54 Y55 I119 Y187 S190 R191 G192 P193 L194

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0045182 translation regulator activity

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation
• GO:0006417 regulation of translation
• GO:0007420 brain development
• GO:1990403 embryonic brain development

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7oya, PDBe:7oya, PDBj:7oya
• PDBsum: 7oya
• PubMed: 36653451
• UniProt: Q7ZV96|RL10_DANRE Large ribosomal subunit protein uL16 (Gene Name=rpl10)