Structure of PDB 6xza Chain I1

Receptor sequence

>6xzaI1 (length=127) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

NQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLE
LVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGF
VTRDARQVERKKVGLRKARRRPQFSKR

3D structure

PDB

6xza Insights into the improved macrolide inhibitory activity from the high-resolution cryo-EM structure of dirithromycin bound to the E. coli 70S ribosome.

Chain

Resolution

2.66 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I1	Y7 T9 R11 R12 K13 S14 R18 F20 R41 Y64 K68 G69 G70 G71 S73 Q75 R85 R99 V104 T105 R106 A108 R109 Q110 V111 E112 R113 K114 K115 V116 G117 R119 K120 R122 R123 R124 Q126 F127	Y4 T6 R8 R9 K10 S11 R15 F17 R38 Y61 K65 G66 G67 G68 S70 Q72 R82 R96 V101 T102 R103 A105 R106 Q107 V108 E109 R110 K111 K112 V113 G114 R116 K117 R119 R120 R121 Q123 F124
BS02	rna	I1	K129 R130	K126 R127

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6xza, PDBe:6xza, PDBj:6xza
PDBsum	6xza
PubMed	32144191
UniProt	P0A7X3\|RS9_ECOLI Small ribosomal subunit protein uS9 (Gene Name=rpsI)

[Back to BioLiP]