Structure of PDB 6tcl Chain I1

Receptor sequence
>6tclI1 (length=31) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence]
ASFLSSIFVPVIGWVVPIATFSFLFLYIERE
3D structure
PDB6tcl Distinct structural modulation of photosystem I and lipid environment stabilizes its tetrameric assembly.
ChainI1
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA I1 L16 S17 I24 L4 S5 I12
BS02 CLA I1 G25 W26 G13 W14
BS03 CLA I1 F33 F37 F21 F25
Gene Ontology
Cellular Component
GO:0009522 photosystem I

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tcl, PDBe:6tcl, PDBj:6tcl
PDBsum6tcl
PubMed32170279
UniProtP58560|PSAI_NOSS1 Photosystem I reaction center subunit VIII (Gene Name=psaI)

[Back to BioLiP]