Structure of PDB 6gzx Chain I1

Receptor sequence

>6gzxI1 (length=138) Species: 300852 (Thermus thermophilus HB8)

MKTYVPKQVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGD
FVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKMLATHPERVLE
HAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKL

3D structure

• PDB: 6gzx Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.
• Chain: I1
• Resolution: 4.57 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I1	M1 T3 K7 L23 G24 R25 T28 K37 P44 N45 T63 K66 K70 Y72 T73 Y75 Y78 G80 G81 L82 K83 K89 H94 E100 H101 A102 G105 M106 L107 P111 L112 R115 K118 R119 K121 H130 Q131 A132	M1 T3 K7 L23 G24 R25 T28 K37 P44 N45 T63 K66 K70 Y72 T73 Y75 Y78 G80 G81 L82 K83 K89 H94 E100 H101 A102 G105 M106 L107 P111 L112 R115 K118 R119 K121 H130 Q131 A132

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6gzx, PDBe:6gzx, PDBj:6gzx
• PDBsum: 6gzx
• PubMed: 30301898
• UniProt: P60488|RL13_THET8 Large ribosomal subunit protein uL13 (Gene Name=rplM)