Structure of PDB 8yfq Chain I |
>8yfqI (length=111) Species: 460519 (Komagataella phaffii) [Search protein sequence] |
SFRFCLECNNMLYPKEDKENQRLLYSCRNCDYTELAEDPKVYRHELITNI GETAGIVDDIGQDPTLPRSDKECPECHSRDCVFFQSQQRRKDTNMTLFYV CLNCKKTFRDE |
|
PDB | 8yfq Structural basis of eukaryotic transcription termination by the Rat1 exonuclease complex. |
Chain | I |
Resolution | 3.3 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
I |
C75 C103 |
C73 C101 |
|
BS02 |
ZN |
I |
C7 C29 |
C5 C27 |
|
|
|