Structure of PDB 8y39 Chain I

Receptor sequence
>8y39I (length=122) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPGG
VVKKGDVVKAVIVRTKSGVRRNDGSYIKFDENACVIIRDDKGPRGTRIFG
PVARELREGNFMKIVSLAPEVL
3D structure
PDB8y39 Synthetic macrolides overcoming MLS B K-resistant pathogens.
ChainI
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna I M1 Q3 Q4 E5 T6 R7 I22 K23 G27 S28 G29 R30 K31 T42 K44 K66 R70 Y76 M1 Q3 Q4 E5 T6 R7 I22 K23 G27 S28 G29 R30 K31 T42 K44 K66 R70 Y76
BS02 rna I P48 R97 P48 R97
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8y39, PDBe:8y39, PDBj:8y39
PDBsum8y39
PubMed38992047
UniProtQ7A081|RL14_STAAW Large ribosomal subunit protein uL14 (Gene Name=rplN)

[Back to BioLiP]