Structure of PDB 8xme Chain I |
>8xmeI (length=113) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] |
STMKFCRECNNILYPKEDKEQKILLYACRNCDHQEVADNSCVYRNEVHHS VSERTQILTDVASDPTLPRTKAVRCSKCQHREAVFFQATARGEEGMTLFF VCCNPNCGHRWRE |
|
PDB | 8xme Transcription of the Plant RNA polymerase IV is prone to backtracking |
Chain | I |
Resolution | 3.1 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
I |
C76 C103 C108 |
C75 C102 C107 |
|
|
|
|