Structure of PDB 8xlp Chain I

Receptor sequence
>8xlpI (length=35) Species: 52970 (Rhodomonas salina) [Search protein sequence]
MFTLKIVVYTTVTLFVSLFTFGFLSNDASRNPNRK
3D structure
PDB8xlp Structure of inactive Photosystem II associated with CAC antenna from Rhodomonas Salina
ChainI
Resolution2.57 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA I V8 Y9 V12 F15 V8 Y9 V12 F15
BS02 WVN I T20 F23 L24 T20 F23 L24
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8xlp, PDBe:8xlp, PDBj:8xlp
PDBsum8xlp
PubMed
UniProtA6MVW0|PSBI_RHDSA Photosystem II reaction center protein I (Gene Name=psbI)

[Back to BioLiP]