Structure of PDB 8wm6 Chain I

Receptor sequence
>8wm6I (length=34) Species: 52970 (Rhodomonas salina) [Search protein sequence]
MTAAYLPSILVPIIGLIFPGLVMAFAFIYIEQDE
3D structure
PDB8wm6 Growth phase-dependent reorganization of cryptophyte photosystem I antennae.
ChainI
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA I L6 P7 V11 I14 L6 P7 V11 I14
BS02 CLA I M23 A24 M23 A24
BS03 CLA I V22 Y29 V22 Y29
BS04 CLA I G15 L16 G15 L16
BS05 WVN I F18 P19 F18 P19
BS06 CLA I S8 I9 P12 I13 L16 I17 S8 I9 P12 I13 L16 I17
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wm6, PDBe:8wm6, PDBj:8wm6
PDBsum8wm6
PubMed38734819
UniProtA6MVV1

[Back to BioLiP]