Structure of PDB 8vk4 Chain I

Receptor sequence
>8vk4I (length=93) Species: 10090 (Mus musculus) [Search protein sequence]
GSELESAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSGFLDVQKD
ADAVDKVMKELDENGDGEVDFKEYVVLVAALTVACNNFFWETS
3D structure
PDB8vk4 Structural insights into the regulation of RyR1 by S100A1.
ChainI
Resolution3.56 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA I D25 K28 L29 E33 D24 K27 L28 E32
BS02 CA I D63 N65 D67 E69 E74 D62 N64 D66 E68 E73
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0044548 S100 protein binding
GO:0046872 metal ion binding
GO:0051117 ATPase binding
Biological Process
GO:0008016 regulation of heart contraction
GO:0051000 positive regulation of nitric-oxide synthase activity
GO:1903672 positive regulation of sprouting angiogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0016529 sarcoplasmic reticulum

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8vk4, PDBe:8vk4, PDBj:8vk4
PDBsum8vk4
PubMed38917010
UniProtQ91V77

[Back to BioLiP]