Structure of PDB 8v9k Chain I

Receptor sequence
>8v9kI (length=126) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
MAKADKATAVADIAEQFKASTATVVTEYRGLTVANLAELRRALGDSATYT
VAKNTLVKRAASEAGIEGLDELFAGPTAIAFVKGEAVDAAKAIKKFAKDN
KALVIKGGYMDGKALSVADVEKIADL
3D structure
PDB8v9k A new family of bacterial ribosome hibernation factors
ChainI
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna I K3 K6 A7 Y28 R29 G30 T32 V33 R40 T50 V51 K53 N54 R59 G75 P76 K3 K6 A7 Y28 R29 G30 T32 V33 R40 T50 V51 K53 N54 R59 G75 P76
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8v9k, PDBe:8v9k, PDBj:8v9k
PDBsum8v9k
PubMed38355796
UniProtA0QS62|RL10_MYCS2 Large ribosomal subunit protein uL10 (Gene Name=rplJ)

[Back to BioLiP]