Structure of PDB 8urx Chain I

Receptor sequence

>8urxI (length=208) Species: 562 (Escherichia coli) [Search protein sequence]

GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKAS
VSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQI
NIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKV
EVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVW
IFKGEILG

3D structure

PDB

8urx Escherichia coli transcription-translation coupled complex class A (TTC-A) containing RfaH bound to ops signal, mRNA with a 21 nt long spacer, and fMet-tRNAs in E-site and P-site of the ribosome

Chain

Resolution

6.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	R72 K79 K80 G81 E82 R132	R71 K78 K79 G80 E81 R131
BS02	rna	I	G2 Q3 K4 V5 I10 R127 S154 G155 R156 E161 I162 A163 W167 R172 V173 P174 H176 T177 L178 R179 T192 V195 G197 K199	G1 Q2 K3 V4 I9 R126 S153 G154 R155 E160 I161 A162 W166 R171 V172 P173 H175 T176 L177 R178 T191 V194 G196 K198

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8urx, PDBe:8urx, PDBj:8urx
PDBsum	8urx
PubMed	39117885
UniProt	B7MCS9\|RS3_ECO45 Small ribosomal subunit protein uS3 (Gene Name=rpsC)

[Back to BioLiP]