Structure of PDB 8uqm Chain I

Receptor sequence

>8uqmI (length=208) Species: 562 (Escherichia coli)

GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKAS
VSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQI
NIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKV
EVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVW
IFKGEILG

3D structure

• PDB: 8uqm Escherichia coli transcription-translation coupled complex class A (TTC-A) containing RfaH bound to ops signal, mRNA with a 21 nt long spacer, and fMet-tRNAs in E-site and P-site of the ribosome
• Chain: I
• Resolution: 5.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	R72 K79 K80 G81 E82 R132	R71 K78 K79 G80 E81 R131
BS02	rna	I	G2 Q3 K4 V5 I10 R127 S154 G155 R156 E161 I162 A163 W167 R172 V173 P174 H176 T177 L178 R179 T192 V195 G197 K199	G1 Q2 K3 V4 I9 R126 S153 G154 R155 E160 I161 A162 W166 R171 V172 P173 H175 T176 L177 R178 T191 V194 G196 K198

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8uqm, PDBe:8uqm, PDBj:8uqm
• PDBsum: 8uqm
• PubMed: 39117885
• UniProt: B7MCS9|RS3_ECO45 Small ribosomal subunit protein uS3 (Gene Name=rpsC)